General Information

  • ID:  hor006719
  • Uniprot ID:  P12836
  • Protein name:  Glycoprotein hormones alpha chain
  • Gene name:  cga
  • Organism:  Muraenesox cinereus (Daggertooth pike conger) (Muraena cinerea)
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Muraenesox (genus), Muraenesocidae (family), Anguilliformes (order), Elopomorpha , Elopocephala , Elopocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0016913 follicle-stimulating hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0010469 regulation of signaling receptor activity; GO:0010893 positive regulation of steroid biosynthetic process
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex

Sequence Information

  • Sequence:  YPNNEISRGGCDECRLKDNKFFSKPSAPIFQCVGCCFSRAYPTPLRSKKTMLVPKDITSEATCCVAREVTKLDNMKLENHTDCHCSTCYYHKS
  • Length:  93(1-93)
  • Propeptide:  YPNNEISRGGCDECRLKDNKFFSKPSAPIFQCVGCCFSRAYPTPLRSKKTMLVPKDITSEATCCVAREVTKLDNMKLENHTDCHCSTCYYHKS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  T79 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Shared alpha chain of heterodimeric glycoprotein hormones. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways. Involved in gametogenesis and steroidogenesis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  11-35; 14-64; 32-83; 36-85; 63-88
  • Structure ID:  AF-P12836-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P12836-F1.pdbhor006719_AF2.pdbhor006719_ESM.pdb

Physical Information

Mass: 1220429 Formula: C452H713N129O139S12
Absent amino acids: W Common amino acids: CK
pI: 8.26 Basic residues: 17
Polar residues: 37 Hydrophobic residues: 20
Hydrophobicity: -58.06 Boman Index: -20567
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 50.32
Instability Index: 4368.17 Extinction Coefficient cystines: 6585
Absorbance 280nm: 71.58

Literature

  • PubMed ID:  2598923
  • Title:  Pike eel (Muraenesox cinereus) gonadotropin. Amino acid sequences of both alpha and beta subunits.